Database
tamarind - Claude MCP Skill
Access a collection of open-source molecular design and structural biology tools on the Tamarind Bio platform, via its REST API or MCP server — no local GPUs required. Tamarind bundles popular open-source models for structure prediction (AlphaFold, Boltz, Chai, ESMFold), protein, binder, and de novo design (RFdiffusion, ProteinMPNN, BoltzGen), antibody and nanobody design and developability, protein-ligand docking (DiffDock, Autodock Vina), binding-affinity prediction, MSA generation, and molecular dynamics. Use when the user mentions Tamarind or tamarind.bio, wants to run any of these open-source tools in the cloud, references app.tamarind.bio/api or the x-api-key header, or needs to submit batches of sequences for structural or biophysical characterization.
SEO Guide: Enhance your AI agent with the tamarind tool. This Model Context Protocol (MCP) server allows Claude Desktop and other LLMs to access a collection of open-source molecular design and structural biology tools on the tamarind bio... Download and configure this skill to unlock new capabilities for your AI workflow.
Documentation
SKILL.md# Tamarind Bio
Tamarind Bio is a cloud platform that runs computational biology tools — structure prediction, protein and antibody design, docking, binding-affinity, MSA generation, and molecular dynamics — on managed GPUs. Users submit sequences or structures and get back predicted structures, designs, and biophysical scores, without provisioning their own hardware. It exposes hundreds of tools (AlphaFold, Boltz-2, Chai-1, RFdiffusion, ProteinMPNN, BoltzGen, ESMFold2, DiffDock, Autodock Vina, and many more) through one uniform job API.
**Official docs:** [app.tamarind.bio/api-docs](https://app.tamarind.bio/api-docs) · platform UI at [app.tamarind.bio](https://app.tamarind.bio)
## Canonical sources — fetch these, don't rely on a stale copy
Tamarind publishes live, machine-readable sources. Prefer fetching them at runtime over trusting any hardcoded list — tool names, schemas, and endpoints change frequently:
- **`https://app.tamarind.bio/llms.txt`** — LLM index: links to the spec, API docs, and MCP guide.
- **`https://app.tamarind.bio/openapi.yaml`** — OpenAPI 3.0 spec for the 8 core job endpoints (submit-job/-batch, jobs, result, upload, files, delete-job/-file; auth `ApiKeyAuth`). Fetch it for those exact shapes. Discovery/management endpoints (`/tools`, `/usage-statistics`, pipelines, …) aren't in it — use the MCP/REST discovery tools for those.
- **`https://docs.tamarind.bio/llms.txt`** — documentation index; every page has a `.md` form (e.g. `docs.tamarind.bio/tamarind/batch.md`, `/tamarind/api.md`, `/tamarind/pipelines.md`).
- **Live tool discovery** — `GET /tools` (REST) or MCP `getAvailableTools` + `getJobSchema(jobType)` are the source of truth for what tools exist and their parameters.
This skill teaches the surface + the non-obvious behaviors those sources don't spell out (see the reference files). When in doubt about a shape, fetch `openapi.yaml`.
## When to use this skill
Use Tamarind when the user wants to:
- **Predict structure** of a protein, complex, or protein-ligand system (AlphaFold, Boltz-2, Chai-1, ESMFold2, Chai/Boltz cofolding)
- **Design proteins or binders** (RFdiffusion, BoltzGen, BindCraft, ProteinMPNN/LigandMPNN inverse folding)
- **Design or characterize antibodies/nanobodies** (sequence generation, humanization, developability, immunogenicity)
- **Dock small molecules** to a protein (DiffDock, Autodock Vina) or predict **binding affinity**
- **Generate MSAs** for downstream folding
- **Run molecular dynamics** or other biophysical workflows on managed GPUs
- **Batch-screen** many sequences or designs through the same tool
- **Chain tools** into pipelines (e.g. design → fold → score) using the output of one job as the input of the next
This skill is the right fit when the work should run on Tamarind's managed cloud rather than on a local install. For purely local cheminformatics or one-off sequence I/O, use a local library (RDKit, BioPython) instead.
## Access and authentication
1. Sign in at [app.tamarind.bio](https://app.tamarind.bio) and create an API key from the account/API settings.
2. Authenticate every REST request with the `x-api-key` header.
3. **Never hardcode the key.** Read it from the `TAMARIND_API_KEY` environment variable or a `.env` file (use `python-dotenv`). Never commit keys to source control.
**Pricing:** Every user gets **10 free jobs**. For larger usage, contact [info@tamarind.bio](mailto:info@tamarind.bio) to purchase a subscription.
```bash
export TAMARIND_API_KEY="your_api_key"
# List available tools
curl https://app.tamarind.bio/api/tools \
-H "x-api-key: $TAMARIND_API_KEY"
```
**Base URL:** `https://app.tamarind.bio/api/`
There is **no official Python SDK** — the PyPI package named `tamarind` is an unrelated Neo4j tool. Do not `uv pip install tamarind`. Write plain `requests` calls against the REST API (the endpoint shapes are in `openapi.yaml`), or use the MCP server for agent hosts.
## Two ways to call Tamarind
### MCP server (best for AI agents)
Tamarind hosts an MCP server at `https://mcp.tamarind.bio/mcp` (API-key auth via the `X-API-Key` header). When your agent host supports MCP, prefer it — the tools mirror the REST API with agent-friendly schemas:
- `listModalities()` / `listTags()` — the live filter vocabulary (molecule type / function) with labels + tool counts; call these to learn valid `modality`/`function` values instead of hardcoding
- `getAvailableTools(modality?, function?, search?, custom?)` — discover tools (`category`/`tag` are deprecated aliases still honored)
- `getJobSchema(jobType)` — exact parameter schema for a tool, plus an `exampleJob` starting payload (validate it before submitting)
- `validateJob(jobName, type, settings)` — dry-run validation before submitting
- `submitJob(jobName, type, settings)` / `submitBatch(batchName, type, settings[], jobNames[])`
- `getJobs(jobName?, batch?, limit?, includeSequences?)` — list/inspect jobs and statuses (the bulky per-job input blob is omitted by default; pass `includeSequences=true` to keep it)
- `getJobLogs(jobName)` — fetch output logs for debugging
- `listJobFiles(jobName)` — list output files (returns `s3Path` for chaining)
- `getResult(jobName, fileName?)` — download results
- `uploadFile(filename)` — presigned upload URL; or `uploadFileContent(filename, content, encoding?)` to send file content through MCP when the host can't reach S3 (sandboxed agents)
Scope note: MCP query tools (`getJobs`, `getResult`, `listJobFiles`, …) are scoped to the authenticated account.
### REST API (universal)
Use plain HTTP with `requests` — the endpoint shapes are in `openapi.yaml`. The core loop is below; `references/workflows.md` has full recipes.
## Core workflow
Always follow discover → schema → validate → submit → poll → results. Do not hardcode tool names or settings — the catalog changes frequently.
```python
import os, time, requests
BASE = "https://app.tamarind.bio/api"
HEADERS = {"x-api-key": os.environ["TAMARIND_API_KEY"]}
# 1. Discover tools. REST /tools returns the full list; filter client-side.
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json()
alphafold = next(t for t in tools if t["name"] == "alphafold")
# 2. Get the exact schema for the chosen tool.
# REST: each /tools entry already includes its inline `settings` schema
# (parameter list) — find the entry whose name == your job type.
# MCP: getJobSchema(jobType) returns the same per-tool detail.
# 3. Submit a job. `settings` is tool-specific — match the schema exactly.
payload = {
"jobName": "my-alphafold-run", # ^[a-zA-Z0-9_-]+$, <=100 chars, unique
"type": "alphafold",
"settings": {
"sequence": "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"numRecycles": 3,
},
}
resp = requests.post(f"{BASE}/submit-job", headers=HEADERS, json=payload)
resp.raise_for_status() # 200 ok; 400 bad request; 403 budget exceeded; 401 unauthorized
# 4. Poll for completion.
# NOTE the response shape: GET /jobs?jobName=<name> returns the job ROW
# directly (no "jobs" wrapper); the list query (no jobName) returns
# {"jobs": [...]}. Don't index ["jobs"][0] on the by-name response.
while True:
job = requests.get(f"{BASE}/jobs", headers=HEADERS,
params={"jobName": "my-alphafold-run"}).json()
if job["JobStatus"] in ("Complete", "Stopped", "Deleted"):
break
time.sleep(30)
# 5. Retrieve results. POST /result returns a presigned URL *string*;
# GET that URL to download the actual results zip (two-step).
url = requests.post(f"{BASE}/result", headers=HEADERS,
json={"jobName": "my-alphafold-run"}).text.strip('"')
open("my-alphafold-run.zip", "wb").write(requests.get(url).content)
```
For the agentic version of this loop using MCP tools, and for richer examples, see `references/workflows.md`.
## Discovering tools
The catalog has hundreds of tools. Always enumerate at runtime — never rely on a hardcoded list.
**REST** `GET /tools` returns the **full list** (it does not filter server-side); each item is `{name, displayName, github, paper, description, settings}` where `settings` is that tool's inline parameter schema. Filter client-side:
```python
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json() # a list
boltz = [t for t in tools if "boltz" in t["name"].lower()]
```
Note: both surfaces return one row per tool name — REST `/tools` and MCP `getAvailableTools` are both deduplicated (the MCP keeps the newest tool version), so a name match returns a single row.
**MCP** `getAvailableTools(search=..., modality=..., function=...)` filters server-side and adds `categories`/`tags` per tool (`category`/`tag` are deprecated aliases of `modality`/`function`, still honored). Don't hardcode the vocabulary — it drifts. Get the live values from `listModalities()` / `listTags()` (each returns `value`, `label`, `description`, and `toolCount`), or read the `availableCategories` / `availableTags` facet arrays returned on every `getAvailableTools` response. Modalities are molecule types (protein, antibody, peptide, small-molecule, nucleic-acid, …); functions are what a tool does (structure-prediction, binder-design, protein-ligand-docking, …).
A representative set of widely-used tools (verify with `/tools`): `alphafold`, `boltz` (Boltz-2), `chai` (Chai-1), `esmfold` / `esmfold2`, `rfdiffusion`, `proteinmpnn`, `ligandmpnn`, `boltzgen`, `bindcraft`, `diffdock`. See `references/tool_catalog.md` for the full category/tag map and how to read tool metadata.
## Choosing the right tool
The catalog has many tools per task; **don't hardcode a favorite — filter by `function` (and `modality`), then read each candidate's `description` and match it to the user's actual goal** (input you have, output you need, constraints like speed or "no MSA"). The `description` and `tags` fields are the public "what it's for" signal; let them, plus `validateJob`, drive the pick. Quick orientation by task:
- **Fold a single protein / complex** (`function=structure-prediction`): the AlphaFold3-class reproductions — `boltz`/`chai`/`openfold`/`protenix`/`intfold` — are the accurate default for **everything**, including protein-only systems; they also handle **nucleic-acid + small-molecule complexes**, so reach for them whenever a ligand/RNA/DNA is part of the system (and `boltz` adds binding-affinity). `alphafold` (AF2) remains a solid choice for monomers + multimers (join chains with `:`). `esmfold` is single-sequence (no MSA) and fast — reach for it when you want speed and have no MSA; `esmfold2` is newer and conditions on an MSA by default (its `model` setting offers a faster single-sequence mode). Specialized folders exist for antibodies (`abodybuilder`, `immunebuilder`), cyclic peptides (`highfold`), and conformational ensembles (`afcluster`, `alphaflow`) — filter and read descriptions.
- **Design a binder** (`function=binder-design`): `bindcraft` (de novo miniprotein binders) and `boltzgen` (binders for protein **and** small-molecule targets, incl. nanobodies/antibodies/peptides) are the go-to de novo binder tools; `rfdiffusion` also does binder design and is the pick for **motif scaffolding** / diversifying an existing backbone. Antibody-specific generators live under `function=antibody-design`.
- **Design sequence for a known backbone** (`function=inverse-folding`): `proteinmpnn` (general), `ligandmpnn` (ligand-aware), plus thermostable/soluble/antibody MPNN variants. Inverse folding takes a **structure** and emits **sequences** — fold them back to verify (see chaining).
- **Dock a small molecule** (`function=protein-ligand-docking`): prefer `boltz`/`chai` — they co-fold the ligand into the complex and predict the bound structure rather than docking into a fixed receptor; reach for `autodock-vina` when you need fast, large-scale screening against a known pocket.
- **Predict binding affinity** (`function=binding-affinity`) or **generate an MSA** (search `msa`) — filter and read.
When the user names a specific tool, evaluate that one **and** sanity-check the alternatives in its `tag` group — a faster or more appropriate sibling often exists. When unsure, `getJobSchema`/`validateJob` to confirm a candidate actually accepts the input you have before committing.
## Job settings, schemas, and validation
Each tool has its own `settings` schema. Fetch it before submitting:
- **REST** `/tools` entry: each `settings` param is a **trimmed** dict. Only `name` and `required` are always present; `type`, `default`, `description`, `options` appear only when relevant (≈60% have `type`) — so use `param.get("type")`, not `param["type"]`. The advanced gating keys (`exclude`, `conditionals`) are **NOT in the REST response** at all.
- **MCP** `getJobSchema(jobType)`: the **full** schema, including `exclude`, `conditionals`, and bounds. Use MCP when you need to reason about those gating keys. (`restrictOrgs` is stripped on both surfaces — an org-gated param you can't use is simply omitted; see `references/api_reference.md`.)
**Always `validateJob` (MCP) before submitting** — it's the reliable guard. It runs the same validation as `/submit-job` without submitting, and surfaces the first missing/invalid field. Don't try to hand-derive which fields to strip from the schema keys (over REST you can't see them anyway) — let `validateJob` tell you. (The response may include a `source` field, e.g. `"static-fallback"` — an internal note on which schema source validated; `valid: true/false` is the signal you act on.)
`validateJob` echoes a `normalized` view of your settings with defaults filled in. Submit the same clean `settings` you validated; treat `normalized` as informational (it can carry defaults you didn't set, and for some tools platform-managed fields), so build your submit from your own settings rather than the normalized blob.
**Sequences:** amino-acid string; separate chains of a multimer with a colon (`:`), e.g. `"MVLS...:EVQL..."`. Note that some tools (e.g. `boltz`, `chai`) require more than `sequence` — `boltz` also requires `inputFormat` (and accepts `yamlFile`/`molecules`). Always `getJobSchema`/`validateJob` to learn a tool's required fields; don't assume `sequence` alone suffices.
**Platform-internal fields** — never set these yourself; the platform owns them: `submit_method`, `monomer_msa`, `msa`. See `references/api_reference.md` for the full field-handling rules.
**Surface consequential choices before submitting, don't default silently.** When the request fully specifies what to run, proceed. But when it's open-ended, or when a setting materially changes the results, runtime, or cost (model/variant, number of samples or seeds, MSA on/off, GPU tier, batch size), present the meaningful options plus the default you'd otherwise apply and let the user pick **before** you submit — rather than choosing silently and reporting it after the job is queued. `getJobSchema` and `validateJob`'s `normalized` show exactly which knobs you're filling in on the user's behalf, so you can flag the few worth a quick confirm. This matters most for **batches**, where one shared-settings choice multiplies across every job.
## File inputs (PDB, CIF, SDF, …)
Tools with file parameters accept input three ways:
1. **Upload first, then reference by bare filename.** `PUT /upload/{filename}`, or MCP `uploadFile` → presigned URL → `curl -X PUT -T file "<url>"`. If your host can't reach S3 (a sandboxed agent with no outbound network), use MCP `uploadFileContent(filename, content, encoding?)` to send the file's content through the MCP channel instead — text by default, `encoding="base64"` for binary. The object lands at the S3 key `{email}/{filename}`, **but you reference it in `settings` by the bare `filename` only** (e.g. `"targetFile": "GLP1R_ECD.pdb"`) — the platform scopes it to your account automatically. **Do NOT prefix the email**: passing `{email}/{filename}` double-prefixes the lookup and `submit-job` 400s with `"The following files have not been uploaded: <email>/<file>"`. Confirm the exact name the store registered with MCP `getFiles(search=...)` / REST `GET /files` (a flat list of bare names).
2. **Reference a prior job's output** by its path: `JobName/path/to/file.ext` (this is how you chain jobs — see below).
3. **Inline content.** Send the file's text content directly as the field value.
**Foot-gun:** for a file-typed parameter, a **plain string value is treated as inline file content**, not as a path to an existing object. To point at an already-uploaded file, use the bare `filename` (not the `{email}/...` S3 key) or, for a prior job's output, the `JobName/...` path form — not a bare string you expect to resolve to new content.
**`validateJob` notes.** The response may carry a `source` field (e.g. `"static-fallback"`) — it labels how the tool's *schema* was resolved (built-in tools always report `static-fallback`), **not** whether the validator was reachable, so act on `valid`, not `source`. For file params: reference an uploaded file by its **bare filename** (above) — a bare name resolves to your account-scoped object, whereas an email-prefixed string can be read as inline content and fail the file-type check (`"... must contain ATOM records"`). And passing **inline** file content makes `validateJob` upload it synchronously before validating, which can be slow; prefer referencing an uploaded file by name (above). If a dry-run is slow, skip it and let `submit-job` validate.
## Chaining jobs into pipelines
A finished job's output becomes the next job's input — no download/re-upload. **Match the input type the next tool actually wants:** a sequence-design tool (ProteinMPNN) emits *sequences*, so you fold them by passing each as a `sequence`; a tool that takes a *file* parameter takes a path.
The cleanest design→fold chain is the MCP `submitBatch(fromJob=...)`, which reads a completed design job's generated sequences and folds each as one job:
```
# ProteinMPNN designs sequences -> fold every one with AlphaFold, one call:
submitBatch(batchName="verify-designs", type="alphafold", fromJob="my-proteinmpnn-job")
```
For a **file** input (e.g. a tool that takes a `.pdb`/`.cif`), reference a prior job's output by the path form `JobName/path/to/file.ext` in that file parameter. Two cautions, both confirmed by validation: (1) match the parameter's required **file type** — e.g. AlphaFold's `templateFiles` accepts only `.cif` and is a list, and is gated behind `templateMode: "custom"`; (2) `templateFiles` is for *structural templates*, not for "fold this designed sequence" — to fold a sequence, pass `sequence`. Always `getJobSchema`/`validateJob` to confirm a file param's type/conditions before chaining into it.
To discover a job's exact output paths, use MCP `listJobFiles(job1)` — it returns each file's `s3Path`, usable directly in the next `submitJob`. (The REST `GET /files` lists your account's *uploaded* files as a flat name list; it does not enumerate a job's outputs.) Tamarind also supports saved **pipelines**: build one in the UI, then drive it with `/run-pipeline` (`{pipelineName, initialInputs, inputs}`) or define `stages[]` inline via `/submit-pipeline` (each stage names a `task` + `toolSettings`, using `"pdbFile": "pipe"` to thread one stage's output into the next). See `references/workflows.md`.
## Batch submission
Submit many jobs of the **same tool** in one call. The Python form uses parallel `settings[]` and `jobNames[]` arrays (same length, up to 100):
```python
requests.post(f"{BASE}/submit-batch", headers=HEADERS, json={
"batchName": "egfr-binder-screen",
"type": "alphafold",
"jobNames": ["seq1", "seq2", "seq3"],
"settings": [{"sequence": "..."}, {"sequence": "..."}, {"sequence": "..."}],
# optional: "maxRuntimeSeconds": 3600, "weightedHoursBudget": 100,
# (some accounts also accept an optional "gpuType" — confirm with support)
})
```
**Poll the batch *parent* on `batchStatus`, not subjob `JobStatus`.** A batch creates a parent job (`Type: "batch"`) plus subjobs. Subjobs flip to `Complete` as soon as they finish computing, but the batch then spends a few minutes **aggregating** results into the final downloadable output. Fetch the parent by name and watch `batchStatus`:
```python
import time
while True:
# ?jobName= returns the parent ROW directly (no "jobs" wrapper)
parent = requests.get(f"{BASE}/jobs", headers=HEADERS,
params={"jobName": "egfr-binder-screen"}).json()
bs = parent.get("batchStatus")
if bs == "Complete":
break
if bs in ("Stopped", "AggregationFailed"):
raise RuntimeError(parent.get("AggregationError", bs))
time.sleep(15) # Running / Aggregating -> keep waiting
# When Complete, the parent carries a presigned `resultUrl` and a `statuses`
# subjob tally ({Complete, Running, In Queue, Stopped}).
open("batch.zip", "wb").write(requests.get(parent["resultUrl"]).content)
```
Add `includeSubjobs=true` to `GET /jobs?batch=<name>` to list per-subjob rows.
## Job status lifecycle
Single jobs report `JobStatus`; batch parents report `batchStatus` (poll that for batches — see above).
| Status | Meaning |
|---|---|
| `In Queue` | Accepted, waiting for capacity |
| `Running` | Executing on a worker |
| `Complete` | Finished successfully — results available |
| `Stopped` | Stopped (failure, timeout, manual stop, or budget) |
| `Deleted` | Job was deleted out-of-band |
| `Aggregating` | (batch parent only) subjobs done; building the final output |
| `AggregationFailed` | (batch parent only) aggregation step failed |
Completed jobs carry a `Score` (tool-specific metrics, e.g. pLDDT/pTM/ipTM for folding) and `WeightedHours`. Treat `Complete`/`Stopped`/`Deleted` (and `AggregationFailed` for batches) as terminal; poll on a 15-30s interval. **Break your poll loop on any terminal status, not just `Complete`/`Stopped`** — a job that goes `Deleted` mid-poll would otherwise loop forever. For a `Stopped` job, fetch `getJobLogs(jobName)` to see why. `WeightedHours` is the usage unit billed per job; cap a batch with `weightedHoursBudget`, and a `403` on submit means a budget was hit (see `references/api_reference.md` and the `/usage-statistics` endpoint).
## Error handling
| Code | Meaning | Action |
|---|---|---|
| 400 | Bad request / invalid settings | Re-check against the schema; run `validateJob` first |
| 401 | Unauthorized | Check `x-api-key` |
| 403 | Budget exceeded (org/team) | Lower scope or raise the budget |
| 429 | Rate limited | Back off and retry |
| 500 | Server error | Retry; if persistent, contact support |
## Reference files
The `openapi.yaml` spec is the source of truth for endpoint shapes; these files add the behaviors and gotchas the spec doesn't spell out:
- `references/examples.md` — **validated** `settings` payloads per common tool (alphafold/boltz/diffdock/autodock-vina/proteinmpnn/batch), a copy-paste self-check, the "what fails and the exact error" list, and output-shape notes. Start here for a working payload.
- `references/api_reference.md` — endpoint quick-reference + the non-obvious shapes: `/jobs` by-name returns a bare row (not `{jobs:[...]}`), `/result` is a two-step download, batch parents poll on `batchStatus`, `/files` is a flat name list, the `settings` field-handling rules.
- `references/tool_catalog.md` — category/tag map, how to read tool + parameter metadata, common tool families.
- `references/workflows.md` — end-to-end recipes: fold a sequence, validate-before-submit, upload + reference a file, design→fold chaining, batch screen with aggregation polling, usage stats, pagination, and the non-blocking submit-now/check-later pattern for long jobs.Signals
Information
- Repository
- K-Dense-AI/claude-scientific-skills
- Author
- K-Dense-AI
- Last Sync
- 9/5/2026
- Repo Updated
- 9/5/2026
- Created
- 6/30/2026
Reviews (0)
No reviews yet. Be the first to review this skill!
Related Skills
upgrade-nodejs
Upgrading Bun's Self-Reported Node.js Version
cursorrules
CrewAI Development Rules
README
Agents — Working Implementations
cn-check
Install and run the Continue CLI (`cn`) to execute AI agent checks on local code changes. Use when asked to "run checks", "lint with AI", "review my changes with cn", or set up Continue CI locally.
Related Guides
Bear Notes Claude Skill: Your AI-Powered Note-Taking Assistant
Learn how to use the bear-notes Claude skill. Complete guide with installation instructions and examples.
OpenAI Whisper API Claude Skill: Complete Guide to AI-Powered Audio Transcription
Learn how to use the openai-whisper-api Claude skill. Complete guide with installation instructions and examples.
Mastering the Oracle CLI: A Complete Guide to the Claude Skill for Database Professionals
Learn how to use the oracle Claude skill. Complete guide with installation instructions and examples.